Overview

  • Product name
    Recombinant Human NANP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGS MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICD KVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLW KSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSY FDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLN AGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 248
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99392 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • 1600031M04Rik
    • C20orf147
    • dJ694B14.3
    • Haloacid dehalogenase like hydrolase domain containing 4
    • Haloacid dehalogenase like hydrolase domain containing protein 4
    • Haloacid dehalogenase-like hydrolase domain-containing protein 4
    • HDHD4
    • MGC103377
    • MGC105812
    • MGC26833
    • N acetylneuraminic acid phosphatase
    • N acylneuraminate 9 phosphatase
    • N-acylneuraminate-9-phosphatase
    • Nanp
    • NANP_HUMAN
    • Neu5Ac 9 Pase
    • Neu5Ac-9-Pase
    • OTTMUSP00000016814
    • RGD1306009
    • RP23-193L22.6
    see all
  • Pathway
    Amino-sugar metabolism; N-acetylneuraminate biosynthesis.
  • Sequence similarities
    Belongs to the HAD-like hydrolase superfamily. NANP family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99392.

References

ab99392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up