Overview

  • Product nameRecombinant Human NANP protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8TBE9
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGS MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICD KVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLW KSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSY FDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLN AGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
    • Molecular weight32 kDa including tags
    • Amino acids1 to 248
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99392 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • 1600031M04Rik
    • C20orf147
    • dJ694B14.3
    • Haloacid dehalogenase like hydrolase domain containing 4
    • Haloacid dehalogenase like hydrolase domain containing protein 4
    • Haloacid dehalogenase-like hydrolase domain-containing protein 4
    • HDHD4
    • MGC103377
    • MGC105812
    • MGC26833
    • N acetylneuraminic acid phosphatase
    • N acylneuraminate 9 phosphatase
    • N-acylneuraminate-9-phosphatase
    • Nanp
    • NANP_HUMAN
    • Neu5Ac 9 Pase
    • Neu5Ac-9-Pase
    • OTTMUSP00000016814
    • RGD1306009
    • RP23-193L22.6
    see all
  • PathwayAmino-sugar metabolism; N-acetylneuraminate biosynthesis.
  • Sequence similaritiesBelongs to the HAD-like hydrolase superfamily. NANP family.
  • Information by UniProt

Recombinant Human NANP protein images

  • 15% SDS-PAGE analysis of 3µg ab99392.

References for Recombinant Human NANP protein (ab99392)

ab99392 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"