Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQ GDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKT YGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFF KVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFC FLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVAL GAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNL VGKKVLVTVEEDDTIMEELVDNHGKKIKS
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 359
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101109 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • EC 2.5.1.56
    • EC 2.5.1.57
    • N acetylneuraminate 9 phosphate synthase
    • N acetylneuraminate synthase
    • N acetylneuraminic acid phosphate synthase
    • N acetylneuraminic acid synthase
    • N-acetylneuraminate synthase
    • N-acetylneuraminate-9-phosphate synthase
    • N-acetylneuraminic acid phosphate synthase
    • N-acetylneuraminic acid synthase
    • NANS
    • OTTHUMP00000021769
    • SAS
    • Sialic acid phosphate synthase
    • Sialic acid synthase
    • SIAS_HUMAN
    see all
  • Function
    Produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN). Can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 AFP-like domain.
  • Information by UniProt

Recombinant Human NANS protein images

  • 15% SDS-PAGE analysis of 3µg ab101109.

References for Recombinant Human NANS protein (ab101109)

ab101109 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up