Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQ GDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALDRPYTSKHSWGKT YGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFF KVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFC FLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVAL GAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNL VGKKVLVTVEEDDTIMEELVDNHGKKIKS
    • Molecular weight
      40 kDa
    • Amino acids
      1 to 359
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.58% Sodium chloride

General Info

  • Alternative names
    • EC 2.5.1.56
    • EC 2.5.1.57
    • N acetylneuraminate 9 phosphate synthase
    • N acetylneuraminate synthase
    • N acetylneuraminic acid phosphate synthase
    • N acetylneuraminic acid synthase
    • N-acetylneuraminate synthase
    • N-acetylneuraminate-9-phosphate synthase
    • N-acetylneuraminic acid phosphate synthase
    • N-acetylneuraminic acid synthase
    • NANS
    • OTTHUMP00000021769
    • SAS
    • Sialic acid phosphate synthase
    • Sialic acid synthase
    • SIAS_HUMAN
    see all
  • Function
    Produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN). Can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 AFP-like domain.
  • Information by UniProt

References

ab172825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up