Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADC AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYREL QR YAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKT AKKG RPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPED VNLRVI SEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLD KTWKGSDH SASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEK LGKSVVAKVK IPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVT VEEDDTIMEELV DNHGKKIKS

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • EC 2.5.1.56
    • EC 2.5.1.57
    • N acetylneuraminate 9 phosphate synthase
    • N acetylneuraminate synthase
    • N acetylneuraminic acid phosphate synthase
    • N acetylneuraminic acid synthase
    • N-acetylneuraminate synthase
    • N-acetylneuraminate-9-phosphate synthase
    • N-acetylneuraminic acid phosphate synthase
    • N-acetylneuraminic acid synthase
    • NANS
    • OTTHUMP00000021769
    • SAS
    • Sialic acid phosphate synthase
    • Sialic acid synthase
    • SIAS_HUMAN
    see all
  • FunctionProduces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN). Can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesContains 1 AFP-like domain.
  • Information by UniProt

References for Recombinant Human NANS protein (ab88843)

ab88843 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"