Overview

  • Product name
    Recombinant Human NAPG protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAAQKINEGLEHLAKAEKYLKTGFLK WKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAK AYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIE NVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALS IQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGF NGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVP GGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 312
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab113164 was purified by using conventional chromatography
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • Gamma SNAP
    • Gamma-soluble NSF attachment protein
    • GAMMASNAP
    • N ethylmaleimide sensitive factor attachment protein gamma
    • N-ethylmaleimide-sensitive factor attachment protein gamma
    • napG
    • SNAG_HUMAN
    • SNAP gamma
    • SNAP-gamma
    • Soluble NSF attachment protein
    • Soluble NSF-attachment protein, gamma
    see all
  • Function
    Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
  • Sequence similarities
    Belongs to the SNAP family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab113164 at 3 µg analysed by 15% SDS PAGE.

References

ab113164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up