Overview

  • Product nameRecombinant Human NAPG protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ99747
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMAAQKINEGLEHLAKAEKYLKTGFLK WKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAK AYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIE NVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALS IQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGF NGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVP GGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
    • Molecular weight37 kDa including tags
    • Amino acids1 to 312
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113164 was purified by using conventional chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • Gamma SNAP
    • Gamma-soluble NSF attachment protein
    • GAMMASNAP
    • N ethylmaleimide sensitive factor attachment protein gamma
    • N-ethylmaleimide-sensitive factor attachment protein gamma
    • napG
    • SNAG_HUMAN
    • SNAP gamma
    • SNAP-gamma
    • Soluble NSF attachment protein
    • Soluble NSF-attachment protein, gamma
    see all
  • FunctionRequired for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
  • Sequence similaritiesBelongs to the SNAP family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human NAPG protein images

  • ab113164 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human NAPG protein (ab113164)

ab113164 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"