Recombinant Human NAPRT1 protein (ab153574)

Overview

  • Product name
    Recombinant Human NAPRT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRD ADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQV SGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQ GPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEV PPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVA YALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDL LQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVN VIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAF RLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLL RLCLQQGQVAAPPPSS
    • Amino acids
      1 to 466
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153574 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FHA HIT interacting protein
    • FHA-HIT-interacting protein
    • FHIP
    • NAPRT1
    • NAPRTase
    • Nicotinate phosphoribosyltransferase
    • Nicotinate phosphoribosyltransferase domain containing 1
    • Nicotinate phosphoribosyltransferase domain-containing protein 1
    • Nicotinic acid phosphoribosyltransferase
    • PNCB_HUMAN
    • PP3856
    see all
  • Function
    Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
  • Pathway
    Cofactor biosynthesis; NAD(+) biosynthesis; nicotinate D-ribonucleotide from nicotinate: step 1/1.
  • Sequence similarities
    Belongs to the NAPRTase family.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • ab153574 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153574 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153574.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up