Recombinant Human Nardilysin protein (ab92081)

Overview

  • Product nameRecombinant Human Nardilysin protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEEKIE NLTEEAFNTQ VTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAH EIEALKSFSKSDLVNWFKAHRG PGSKMLSVHVVGYGKYELEEDGTPSS EDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAF TTTLNLLPYHK
    • Amino acids958 to 1148

Specifications

Our Abpromise guarantee covers the use of ab92081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 92 µl aqua dest.

General Info

  • Alternative names
    • EC 3.4.24.61
    • hNRD1
    • hNRD2
    • N arginine dibasic convertase
    • Nardilysin precursor
    • NRD C
    • NRD convertase
    • NRD1
    see all
  • RelevanceA member of the metalloproteinase family M16, nardilysin is most similar to insulin degrading enzyme, and the bacterial peptidase pitrilysin. It cleaves peptide substrates on the N terminus of arginine residues in dibasic pairs. Nardilysin was first described as a processing enzyme of somatostatin 1-28, which is cleaved at the Arg-Lys paired amino acid location. Nardilysin was named N arginine dibasic convertase (NRD convertase) to reflect this cleavage, although it was later shown that the activity was due to aminopeptidase B acting as a heterodimer with nardilysin. In addition to somatostatin 1-28, nardilysin cleaves dynorphin A and a-neoendorphin. Nardilysin was first detected in the brain and testis, and later in the heart, skeletal muscle, and in lesser amounts in most tissues and cell lines.

Recombinant Human Nardilysin protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human Nardilysin protein (ab92081)

ab92081 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"