Overview

  • Product name
    Recombinant Human NARG1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGS LGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEEL
    • Amino acids
      764 to 862
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5730450D16Rik
    • 6330400I15
    • ASTBDN
    • GA19
    • Gastric cancer antigen Ga19
    • MGC29428
    • mNAT1
    • N alpha acetyltransferase 15, NatA auxiliary subunit
    • N terminal acetyltransferase
    • N(alpha) acetyltransferase 15, NatA auxiliary subunit
    • N-alpha-acetyltransferase 15
    • N-terminal acetyltransferase
    • Naa15
    • NAA15_HUMAN
    • NatA auxiliary subunit
    • NATH
    • NMDA receptor regulated 1
    • NMDA receptor regulated protein 1
    • NMDA receptor-regulated protein 1
    • Protein tubedown 1
    • Protein tubedown-1
    • Tbdn 1
    • Tbdn100
    • Transcriptional coactivator tubedown 100
    • tubedown-1
    see all
  • Function
    The NAA10-NAA15 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.
  • Tissue specificity
    Expressed at high levels in testis and in ocular endothelial cells. Also found in brain (corpus callosum), heart, colon, bone marrow and at lower levels in most adult tissues, including thyroid, liver, pancreas, mammary and salivary glands, lung, ovary, urogenital system and upper gastrointestinal tract. Overexpressed in gastric cancer, in papillary thyroid carcinomas and in a Burkitt lymphoma cell line (Daudi). Specifically suppressed in abnormal proliferating blood vessels in eyes of patients with proliferative diabetic retinopathy.
  • Sequence similarities
    Contains 8 TPR repeats.
  • Post-translational
    modifications
    Cleaved by caspases during apoptosis, resulting in a stable 35 kDa fragment.
  • Cellular localization
    Cytoplasm. Nucleus. Mainly cytoplasmic, nuclear in some cases. Present in the free cytosolic and cytoskeleton-bound polysomes, but not in the membrane-bound polysomes.
  • Information by UniProt

Images

  • ab164208 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up