Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYK REGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYP RFVQRCT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      441 to 547

Specifications

Our Abpromise guarantee covers the use of ab117043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3010001M15Rik
    • AA960128
    • AsnRS
    • ASNS
    • Asparagine tRNA ligase
    • Asparagine tRNA ligase 1, cytoplasmic
    • Asparagine--tRNA ligase
    • Asparaginyl tRNA synthetase
    • Asparaginyl-tRNA synthetase
    • C78150
    • cytoplasmic
    • EC 6.1.1.22
    • LRRGT00113
    • MGC116236
    • Nars
    • NARS1
    • NRS
    • SYNC_HUMAN
    see all
  • Sequence similarities
    Belongs to the class-II aminoacyl-tRNA synthetase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117043 at approximately 37.40 kDa.

References

ab117043 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up