Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43776
    • SpeciesHuman
    • SequencePVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYK REGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYP RFVQRCT
    • Molecular weight37 kDa including tags
    • Amino acids441 to 547

Specifications

Our Abpromise guarantee covers the use of ab117043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3010001M15Rik
    • AA960128
    • AsnRS
    • ASNS
    • Asparagine tRNA ligase
    • Asparagine tRNA ligase 1, cytoplasmic
    • Asparagine--tRNA ligase
    • Asparaginyl tRNA synthetase
    • Asparaginyl-tRNA synthetase
    • C78150
    • cytoplasmic
    • EC 6.1.1.22
    • LRRGT00113
    • MGC116236
    • Nars
    • NARS1
    • NRS
    • SYNC_HUMAN
    see all
  • Sequence similaritiesBelongs to the class-II aminoacyl-tRNA synthetase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human NARS protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117043 at approximately 37.40 kDa.

References for Recombinant Human NARS protein (ab117043)

ab117043 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"