Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDIEAYLERIGYKKSRNKLDLETLTDILQH QIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALT TIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQ MWQPLELISGKDQPQVPCIFRLTEENGFWYLDQIRREQYIPNEEFLHSDL LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPASVFTSKSFCSLQTPDG VHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLV PKHGDRFFTI
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 290
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab109846 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.316% Tris HCl, 0.058% Sodium chloride, 0.0308% DTT, pH 8.0

General Info

  • Alternative names
    • AAC1
    • ARY1_HUMAN
    • Arylamide acetylase 1
    • Arylamine N acetyltransferase 1
    • Arylamine N-acetyltransferase 1
    • mNAT
    • Monomorphic arylamine N acetyltransferase
    • Monomorphic arylamine N-acetyltransferase
    • N acetyltransferase type 1
    • N-acetyltransferase type 1
    • NAT 1
    • NAT-1
    • nat1
    • NATI
    see all
  • Function
    Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
  • Sequence similarities
    Belongs to the arylamine N-acetyltransferase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109846 at approximately 36.1 kDa (3µg).

References

ab109846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up