Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKA RPSVLWCYKKELGFSSHRKKRMRQLQKKIKNGTLNIKQDDPFELFIA
    • Amino acids
      2 to 98
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALP
    • DKFZp434C116
    • FLJ10774
    • FLJ12179
    • FLJ23850
    • hALP
    • KIAA1709
    • N acetyltransferase 10
    • N acetyltransferase 10 GCN5 related
    • N acetyltransferase like
    • N acetyltransferase like protein
    • N-acetyltransferase 10
    • NAT10
    • NAT10_HUMAN
    • NET43
    see all
  • Function
    Has protein acetyltransferase activity in vitro. Can acetylate both histones and microtubules. Histone acetylation may regulate transcription and mitotic chromosome de-condensation. Activates telomerase activity by stimulating the transcription of TERT, and may also regulate telomerase function by affecting the balance of telomerase subunit assembly, disassembly, and localization. Acetylates alpha-tubulin, which may affect microtubule stability and cell division.
  • Sequence similarities
    Belongs to the UPF0202 family.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Nucleus > nucleolus. Nucleolar in interphase and redistributes to the perichromosomal layer and to the midbody during telophase.
  • Information by UniProt

Images

  • ab163026 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up