Overview

  • Product nameRecombinant Human NAT13 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9GZZ1
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMKGSRIELGDVTPHNIKQLKRLNQVI FPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMT LGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRK FGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
    • Molecular weight22 kDa including tags
    • Amino acids1 to 169
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab123145 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • MAK3
    • FLJ13194
    • hNAT5
    • hSAN
    • Mak3 homolog
    • Mak3 homolog (S. cerevisiae)
    • N-acetyltransferase 13
    • N-acetyltransferase 13 (GCN5-related)
    • N-acetyltransferase 5
    • N-acetyltransferase san homolog
    • N-alpha-acetyltransferase 50
    • N-alpha-acetyltransferase 50, NatE catalytic subunit
    • Naa50
    • NAA50_HUMAN
    • NAT 5
    • NAT13
    • NAT5
    • NatE catalytic subunit
    • San
    see all
  • FunctionProbable catalytic component of the NAA11-NAA15 complex which displays alpha (N-terminal) acetyltransferase activity.
  • Sequence similaritiesBelongs to the acetyltransferase family. GNAT subfamily.
    Contains 1 N-acetyltransferase domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human NAT13 protein images

  • 15% SDS PAGE, 3 µg of ab123145 loaded.

References for Recombinant Human NAT13 protein (ab123145)

ab123145 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"