Overview

  • Product name
    Recombinant Human NAT13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMKGSRIELGDVTPHNIKQLKRLNQVI FPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMT LGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRK FGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 169
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab123145 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • MAK3
    • FLJ13194
    • hNAT5
    • hSAN
    • Mak3 homolog
    • Mak3 homolog (S. cerevisiae)
    • N-acetyltransferase 13
    • N-acetyltransferase 13 (GCN5-related)
    • N-acetyltransferase 5
    • N-acetyltransferase san homolog
    • N-alpha-acetyltransferase 50
    • N-alpha-acetyltransferase 50, NatE catalytic subunit
    • Naa50
    • NAA50_HUMAN
    • NAT 5
    • NAT13
    • NAT5
    • NatE catalytic subunit
    • San
    see all
  • Function
    Probable catalytic component of the NAA11-NAA15 complex which displays alpha (N-terminal) acetyltransferase activity.
  • Sequence similarities
    Belongs to the acetyltransferase family. GNAT subfamily.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human NAT13 protein images

  • 15% SDS PAGE, 3 µg of ab123145 loaded.

References for Recombinant Human NAT13 protein (ab123145)

ab123145 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up