Overview

  • Product name
    Recombinant Human NAT13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMKGSRIELGDVTPHNIKQLKRLNQVI FPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMT LGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRK FGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 169
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab123145 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • MAK3
    • FLJ13194
    • hNAT5
    • hSAN
    • Mak3 homolog
    • Mak3 homolog (S. cerevisiae)
    • N-acetyltransferase 13
    • N-acetyltransferase 13 (GCN5-related)
    • N-acetyltransferase 5
    • N-acetyltransferase san homolog
    • N-alpha-acetyltransferase 50
    • N-alpha-acetyltransferase 50, NatE catalytic subunit
    • Naa50
    • NAA50_HUMAN
    • NAT 5
    • NAT13
    • NAT5
    • NatE catalytic subunit
    • San
    see all
  • Function
    Probable catalytic component of the NAA11-NAA15 complex which displays alpha (N-terminal) acetyltransferase activity.
  • Sequence similarities
    Belongs to the acetyltransferase family. GNAT subfamily.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS PAGE, 3 µg of ab123145 loaded.

References

ab123145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up