Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTL REKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSN
    • Amino acids
      83 to 179
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acetyltransferase 1
    • ATase1
    • Camello like protein 2
    • Camello-like protein 2
    • CML2
    • Hcml2
    • N acetyltransferase 8B
    • N acetyltransferase Camello 2
    • NAT8B
    • NAT8B_HUMAN
    • NAT8BP
    • Probable N acetyltransferase 8B
    • Putative N-acetyltransferase 8B
    see all
  • Function
    May have a lysine N-acetyltransferase activity catalyzing peptidyl-lysine N6-acetylation of various proteins. Thereby, may regulate apoptosis through the acetylation and the regulation of the expression of PROM1 (PubMed:24556617). May also regulate amyloid beta-peptide secretion through acetylation of BACE1 and the regulation of its expression in neurons (PubMed:19011241).
  • Sequence similarities
    Belongs to the camello family.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Endoplasmic reticulum-Golgi intermediate compartment membrane. Endoplasmic reticulum membrane. Enriched in the Endoplasmic reticulum-Golgi intermediate compartment.
  • Information by UniProt

Images

  • ab162568 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up