Recombinant Human Natriuretic Peptide Receptor A protein (ab112332)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP16066
    • SpeciesHuman
    • SequenceGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHC FFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICS S
    • Molecular weight37 kDa including tags
    • Amino acids147 to 247
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein. useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • ANP-A
    • ANPa
    • ANPR-A
    • ANPRA
    • ANPRA_HUMAN
    • Atrial natriuretic peptide A type receptor
    • Atrial natriuretic peptide receptor 1
    • Atrial natriuretic peptide receptor A
    • Atrial natriuretic peptide receptor type A
    • Atrionatriuretic peptide receptor A
    • GC A
    • GC-A
    • Guanylate cyclase
    • Guanylate cyclase A
    • GUC2A
    • GUCY2A
    • Natriuretic peptide A type receptor
    • Natriuretic peptide receptor A/guanylate cyclase A
    • NPR-A
    • NPR1
    • NPRA
    see all
  • FunctionReceptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.
  • Sequence similaritiesBelongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 1 guanylate cyclase domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylation of the protein kinase-like domain is required for full activation by ANP.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Natriuretic Peptide Receptor A protein images

  • ab112332 run on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Natriuretic Peptide Receptor A protein (ab112332)

ab112332 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"