Recombinant Human Natriuretic Peptide Receptor B protein (ab114435)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      131 to 230

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMDM
    • ANP-B
    • ANPB
    • ANPR-B
    • ANPRB
    • ANPRB_HUMAN
    • Atrial natriuretic peptide B type receptor
    • Atrial natriuretic peptide receptor 2
    • Atrial natriuretic peptide receptor type B
    • Atrionatriuretic peptide receptor B
    • GC-B
    • GCB
    • Guanylate cyclase B
    • GUC 2B
    • GUC2B
    • GUCY2B
    • Natriuretic peptide receptor B
    • Natriuretic peptide receptor B/guanylate cyclase B
    • NPR-B
    • Npr2
    • NPRB
    • NPRBi
    see all
  • Function
    Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.
  • Involvement in disease
    Defects in NPR2 are the cause of acromesomelic dysplasia Maroteaux type (AMDM) [MIM:602875]. Acromesomelic chondrodysplasias are rare hereditary skeletal disorders characterized by short stature, very short limbs, and hand/foot malformations. The severity of limb abnormalities increases from proximal to distal with profoundly affected hands and feet showing brachydactyly and/or rudimentary fingers (knob-like fingers). AMDM is an autosomal recessive form characterized by axial skeletal involvement with wedging of vertebral bodies. In AMDM all skeletal elements are present but show abnormal rates of linear growth.
  • Sequence similarities
    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 1 guanylate cyclase domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylation of the protein kinase-like domain is required for full activation by CNP.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Natriuretic Peptide Receptor B protein images

  • ab114435 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Natriuretic Peptide Receptor B protein (ab114435)

ab114435 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up