Recombinant Human Nav1.6 protein (ab152670)

Overview

  • Product name
    Recombinant Human Nav1.6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQ RAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1854 to 1951

Specifications

Our Abpromise guarantee covers the use of ab152670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CerIII
    • CIAT
    • EIEE13
    • hNa6/Scn8a voltage gated sodium channel
    • MED
    • Motor endplate disease
    • NaCh 6
    • NaCh6
    • Nav 1.6
    • Nbna1
    • peripheral nerve protein type 4
    • PN 4
    • PN4
    • SCN8A
    • SCN8A_HUMAN
    • Sodium channel protein type 8 alpha subunit
    • Sodium channel protein type 8 subunit alpha
    • Sodium channel protein type VIII alpha subunit
    • Sodium channel protein type VIII subunit alpha
    • Sodium channel voltage gated type VIII alpha
    • Sodium channel voltage gated type VIII alpha polypeptide
    • Sodium channel voltage gated type VIII alpha subunit
    • Voltage gated sodium channel subunit alpha Nav1.6
    • Voltage-gated sodium channel subunit alpha Nav1.6
    see all
  • Function
    Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. In macrophages and melanoma cells, isoform 5 may participate in the control of podosome and invadopodia formation.
  • Tissue specificity
    Isoform 5 is expressed in non-neuronal tissues, such as monocytes/macrophages.
  • Sequence similarities
    Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.6/SCN8A subfamily.
    Contains 1 IQ domain.
  • Domain
    The sequence contains 4 internal repeats, each with 5 hydrophobic segments (S1,S2,S3,S5,S6) and one positively charged segment (S4). Segments S4 are probably the voltage-sensors and are characterized by a series of positively charged amino acids at every third position.
  • Post-translational
    modifications
    May be ubiquitinated by NEDD4L; which would promote its endocytosis.
  • Cellular localization
    Membrane and Cytoplasmic vesicle. Some vesicles are localized adjacent to melanoma invadopodia and macrophage podosomes. Does not localize to the plasma membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152670 stained with Coomassie Blue.

References

ab152670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up