Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALS SAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS
    • Amino acids
      1878 to 1973
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5330421F07Rik
    • AU067780
    • FLJ10633
    • FLJ11030
    • FLJ23707
    • HELAD1
    • Helicase, APC down regulated 1
    • KIAA1419
    • mCG 145366
    • mKIAA3015
    • NAV 2
    • Neuron navigator 2
    • POMFIL2
    • Pore membrane and/or filament interacting like protein 2
    • RAINB1
    • RAINB2
    • Retinoic acid inducible gene in neuroblastoma 1
    • Retinoic acid inducible in neuroblastoma 1
    • Steerin 2
    • STEERIN2
    • Unc 53 homolog 2
    • Unc53H2
    see all
  • Relevance
    NAV2 protein shows high similarity to Caenorhabditis elegans, unc-53, that is required for axonal elongation of mechanosensory neurons, suggesting that these proteins are orthologs. Thus, NAV2 may be involved in the vitamin A metabolite, atRA (all-trans retinoic acid)-mediated neurite outgrowth. NAV2 possesses 3' to 5' helicase activity and exonuclease activity and is involved in the development of different sensory organs.
  • Cellular localization
    Nuclear

Images

  • ab164782 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up