Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDE ENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
    • Molecular weight
      36 kDa including tags
    • Amino acids
      2 to 96

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1A1 3B
    • 1A13B
    • B box protein
    • Cell migration-inducing gene 19 protein
    • KIAA0049
    • M17S2
    • Membrane component chromosome 17 surface marker 2
    • Membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125)
    • MIG 19
    • MIG19
    • Migration inducing protein 19
    • NBR 1
    • Nbr1
    • NBR1, autophagy cargo receptor
    • NBR1_HUMAN
    • Neighbor of BRCA1 gene 1
    • Neighbor of BRCA1 gene 1 protein
    • Next to BRCA1 gene 1 protein
    • Ovarian carcinoma antigen CA125
    • Protein 1A1-3B
    see all
  • Function
    Acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets.
  • Sequence similarities
    Contains 1 OPR domain.
    Contains 1 UBA domain.
    Contains 1 ZZ-type zinc finger.
  • Domain
    The OPR domain mediates interaction with SQSTM1.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle > autophagosome. Lysosome. Cytoplasm > myofibril > sarcomere > M line. In cardiac muscles localizes to the sarcomeric M line (By similarity). Is targeted to lysosomes for degradation.
  • Information by UniProt

Recombinant Human NBR1 protein images

  • 12.5% SDS-PAGE with ab114377 at approximately 36.08kDa stained with Coomassie Blue.

References for Recombinant Human NBR1 protein (ab114377)

ab114377 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up