Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14596
    • SpeciesHuman
    • SequenceEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDE ENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
    • Molecular weight36 kDa including tags
    • Amino acids2 to 96

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1A1 3B
    • 1A13B
    • Cell migration-inducing gene 19 protein
    • KIAA0049
    • M17S2
    • Membrane component chromosome 17 surface marker 2
    • MIG 19
    • MIG19
    • Migration inducing protein 19
    • NBR 1
    • Nbr1
    • NBR1_HUMAN
    • Neighbor of BRCA1 gene 1
    • Neighbor of BRCA1 gene 1 protein
    • Next to BRCA1 gene 1 protein
    • Ovarian carcinoma antigen CA125
    • Protein 1A1-3B
    see all
  • FunctionActs probably as a receptor for selective autophagosomal degradation of ubiquitinated targets.
  • Sequence similaritiesContains 1 OPR domain.
    Contains 1 UBA domain.
    Contains 1 ZZ-type zinc finger.
  • DomainThe OPR domain mediates interaction with SQSTM1.
  • Cellular localizationCytoplasm. Cytoplasmic vesicle > autophagosome. Lysosome. Cytoplasm > myofibril > sarcomere > M line. In cardiac muscles localizes to the sarcomeric M line (By similarity). Is targeted to lysosomes for degradation.
  • Information by UniProt

Recombinant Human NBR1 protein images

  • 12.5% SDS-PAGE with ab114377 at approximately 36.08kDa stained with Coomassie Blue.

References for Recombinant Human NBR1 protein (ab114377)

ab114377 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"