Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDE ENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
    • Molecular weight
      36 kDa including tags
    • Amino acids
      2 to 96

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1A1 3B
    • 1A13B
    • B box protein
    • Cell migration-inducing gene 19 protein
    • KIAA0049
    • M17S2
    • Membrane component chromosome 17 surface marker 2
    • Membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125)
    • MIG 19
    • MIG19
    • Migration inducing protein 19
    • NBR 1
    • Nbr1
    • NBR1, autophagy cargo receptor
    • NBR1_HUMAN
    • Neighbor of BRCA1 gene 1
    • Neighbor of BRCA1 gene 1 protein
    • Next to BRCA1 gene 1 protein
    • Ovarian carcinoma antigen CA125
    • Protein 1A1-3B
    see all
  • Function
    Acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets.
  • Sequence similarities
    Contains 1 OPR domain.
    Contains 1 UBA domain.
    Contains 1 ZZ-type zinc finger.
  • Domain
    The OPR domain mediates interaction with SQSTM1.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle > autophagosome. Lysosome. Cytoplasm > myofibril > sarcomere > M line. In cardiac muscles localizes to the sarcomeric M line (By similarity). Is targeted to lysosomes for degradation.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE with ab114377 at approximately 36.08kDa stained with Coomassie Blue.

References

ab114377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up