Overview

  • Product name
    Recombinant Human NBR2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKDLSSGFPSF LTSSILWKSAVVREPHISPHQAPPYKTSDCIT
    • Amino acids
      1 to 82
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • neighbor of BRCA1 gene 2
    • Next to BRCA1 gene 2
  • Relevance
    The gene encoding NBR 2 was identified by its close proximity on chromosome 17 to tumor suppressor gene BRCA1. The head to head location of this gene and BRCA1 suggested that both genes may be coordinated through a bi-directional promoter. The specific function of this gene has not yet been determined.

Images

  • ab160892 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up