Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      611 to 710

Specifications

Our Abpromise guarantee covers the use of ab114198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • antigen MSK39 identified by monoclonal antibody 5.1H11
    • antigen recognized by monoclonal antibody 5.1H11
    • CD56
    • cell adhesion molecule, neural, 1
    • MSK 39
    • MSK39
    • N-CAM-1
    • NCAM
    • NCAM 1
    • NCAM C
    • NCAM-1
    • NCAM1
    • NCAM1_HUMAN
    • NCAMC
    • Neural cell adhesion molecule 1
    • Neural cell adhesion molecule NCAM
    • OTTHUMP00000235666
    see all
  • Function
    This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.
  • Sequence similarities
    Contains 2 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab114198 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue

References

ab114198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up