Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      611 to 710

Specifications

Our Abpromise guarantee covers the use of ab114198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • antigen MSK39 identified by monoclonal antibody 5.1H11
    • antigen recognized by monoclonal antibody 5.1H11
    • CD56
    • cell adhesion molecule, neural, 1
    • MSK 39
    • MSK39
    • N-CAM-1
    • NCAM
    • NCAM 1
    • NCAM C
    • NCAM-1
    • NCAM1
    • NCAM1_HUMAN
    • NCAMC
    • Neural cell adhesion molecule 1
    • Neural cell adhesion molecule NCAM
    • OTTHUMP00000235666
    see all
  • Function
    This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.
  • Sequence similarities
    Contains 2 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Recombinant Human NCAM protein images

  • ab114198 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue

References for Recombinant Human NCAM protein (ab114198)

ab114198 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up