Overview

  • Product name
    Recombinant Human NCAM2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGN KDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      598 to 695

Specifications

Our Abpromise guarantee covers the use of ab114921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cell adhesion molecule, neural, 2
    • MGC51008
    • N CAM 2
    • N CAM 21
    • N CAM2
    • N CAM21
    • N-CAM-2
    • NCAM 2
    • NCAM 21
    • NCAM-2
    • Ncam2
    • NCAM2_HUMAN
    • NCAM21
    • Neural cell adhesion molecule 2
    • OCAM GPI
    • R4B12
    • RB 8 neural cell adhesion molecule
    • RB8 neural cell adhesion molecule
    • RNCAM
    see all
  • Function
    May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
  • Tissue specificity
    Expressed most strongly in adult and fetal brain.
  • Sequence similarities
    Contains 2 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human NCAM2 protein images

  • 12.5% SDS-PAGE showing ab114921 at approximately 36.41kDa.
    Stained with Coomassie Blue.

References for Recombinant Human NCAM2 protein (ab114921)

ab114921 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up