Overview

  • Product name
    Recombinant Human NCAM2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGN KDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      598 to 695

Specifications

Our Abpromise guarantee covers the use of ab114921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cell adhesion molecule, neural, 2
    • MGC51008
    • N CAM 2
    • N CAM 21
    • N CAM2
    • N CAM21
    • N-CAM-2
    • NCAM 2
    • NCAM 21
    • NCAM-2
    • Ncam2
    • NCAM2_HUMAN
    • NCAM21
    • Neural cell adhesion molecule 2
    • OCAM GPI
    • R4B12
    • RB 8 neural cell adhesion molecule
    • RB8 neural cell adhesion molecule
    • RNCAM
    see all
  • Function
    May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
  • Tissue specificity
    Expressed most strongly in adult and fetal brain.
  • Sequence similarities
    Contains 2 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114921 at approximately 36.41kDa.
    Stained with Coomassie Blue.

References

ab114921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up