Overview

  • Product nameRecombinant Human NCAM2 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15394
    • SpeciesHuman
    • SequenceSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGN KDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTL
    • Molecular weight36 kDa including tags
    • Amino acids598 to 695

Specifications

Our Abpromise guarantee covers the use of ab114921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cell adhesion molecule, neural, 2
    • MGC51008
    • N CAM 2
    • N CAM 21
    • N CAM2
    • N CAM21
    • N-CAM-2
    • NCAM 2
    • NCAM 21
    • NCAM-2
    • Ncam2
    • NCAM2_HUMAN
    • NCAM21
    • Neural cell adhesion molecule 2
    • OCAM GPI
    • R4B12
    • RB 8 neural cell adhesion molecule
    • RB8 neural cell adhesion molecule
    • RNCAM
    see all
  • FunctionMay play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
  • Tissue specificityExpressed most strongly in adult and fetal brain.
  • Sequence similaritiesContains 2 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human NCAM2 protein images

  • 12.5% SDS-PAGE showing ab114921 at approximately 36.41kDa.
    Stained with Coomassie Blue.

References for Recombinant Human NCAM2 protein (ab114921)

ab114921 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"