Recombinant Human NCF1 protein (ab98054)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEF HKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCST LMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTAT DITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKA KRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEG EAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPP RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAVVEHHHHHH
    • Molecular weight
      46 kDa including tags
    • Amino acids
      1 to 390
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab98054 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 47 kDa autosomal chronic granulomatous disease protein
    • 47 kDa neutrophil oxidase factor
    • NADPH oxidase organizer 2
    • NCF 47K
    • NCF-1
    • NCF-47K
    • Ncf1
    • NCF1_HUMAN
    • Neutrophil cytosol factor 1
    • Neutrophil cytosolic factor 1
    • neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1)
    • Neutrophil NADPH oxidase factor 1
    • Nox organizer 2
    • Nox organizing protein 2
    • Nox-organizing protein 2
    • NOXO2
    • p47 phox
    • p47-phox
    • SH3 and PX domain containing protein 1A
    • SH3 and PX domain-containing protein 1A
    • SH3PXD1A
    see all
  • Function
    NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
  • Involvement in disease
    Defects in NCF1 are the cause of chronic granulomatous disease autosomal recessive cytochrome-b-positive type 1 (CGD1) [MIM:233700]. Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.
  • Sequence similarities
    Contains 1 PX (phox homology) domain.
    Contains 2 SH3 domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human NCF1 protein images

  • Anti-NCF1 antibody (ab795) at 1.5 µg/ml + Recombinant Human NCF1 protein (ab98054) at 0.1 µg

    Secondary
    Rabbit polyclonal to Goat IgG - H&L - Pre-Adsorbed (HRP) (ab65486) at 1/3000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 8 minutes
  • 15% SDS-PAGE analysis of 3µg ab98054

References for Recombinant Human NCF1 protein (ab98054)

ab98054 has not yet been referenced specifically in any publications.

Product Wall

Vielen Dank für Ihre Anfrage. Gegen die genannten NADPH-Oxidase-Komponenten haben wir folgende Antikörper bzw. Proteine in unserem Katalog: Click here (or use the following: http://www.abcam.com/index.html?datasheet=109366). Click here (or use the...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up