Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAEEVVVVAKFDYVAQQEQELDIKKNERLW LLDDSKSWWRVRNSM NKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADD SFVDPGERLYDLNMP AYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYV TEEGDSPLGDHVGSL SEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPEN DPEWWKCRKINGMVG LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRH QAEMALNERGHEGDF LIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEH YKKAPIFTSEQGEKL YLVKHLS
    • Molecular weight
      43 kDa
    • Amino acids
      1 to 377
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Please see notes section.

    pH: 8.00
    Constituents: 0.24% Tris, 0.29% Sodium chloride

    Supplied as a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • Cytoplasmic protein NCK1
    • Melanoma Nck protein
    • MGC12668
    • NCK
    • NCK 1
    • NCK adaptor protein 1
    • NCK alpha
    • NCK tyrosine kinase
    • Nck-1
    • NCK1
    • NCK1_HUMAN
    • NCKalpha
    • Non catalytic region of tyrosine kinase
    • SH2/SH3 adaptor protein NCK alpha
    • SH2/SH3 adaptor protein NCK-alpha
    see all
  • Function
    Adapter protein which associates with tyrosine-phosphorylated growth factor receptors or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in the DNA damage response, not in the detection of the damage by ATM/ATR, but for efficient activation of downstream effectors, such as that of CHEK2.
  • Sequence similarities
    Contains 1 SH2 domain.
    Contains 3 SH3 domains.
  • Post-translational
    modifications
    Phosphorylated on Ser and Tyr residues.
  • Cellular localization
    Cytoplasm. Endoplasmic reticulum. Nucleus. Mostly cytoplasmic, but shuttles between the cytoplasm and the nucleus. Import into the nucleus requires the interaction with SOCS7. Predominantly nuclear following genotoxic stresses, such as UV irradiation, hydroxyurea or mitomycin C treatments.
  • Information by UniProt

References

ab172816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up