Recombinant Human NCKAP1 protein (ab153130)

Overview

  • Product name
    Recombinant Human NCKAP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLID KNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDV MEFKDHVCEL
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11291
    • KIAA0587
    • Membrane associated protein HEM2
    • Membrane-associated protein HEM-2
    • MGC8981
    • NAP 1
    • NAP1
    • NAP125
    • NCK associated protein
    • NCK associated protein 1
    • Nck-associated protein 1
    • Nckap1
    • NCKP1_HUMAN
    • OTTHUMP00000163460
    • OTTHUMP00000163461
    • p125Nap1
    see all
  • Function
    Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1.
  • Tissue specificity
    Expressed in all tissues examined except peripheral blood leukocytes, with highest expression in brain, heart, and skeletal muscle.
  • Sequence similarities
    Belongs to the HEM-1/HEM-2 family.
  • Cellular localization
    Cell membrane. Cell projection > lamellipodium membrane. At the interface between the lamellipodial actin meshwork and the membrane.
  • Information by UniProt

Images

  • ab153130 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up