Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSS GEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKE KWLYRTPLQM
    • Amino acids
      505 to 614
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 70 kDa androgen receptor activator
    • 70 kDa androgen receptor coactivator
    • 70 kDa AR activator
    • 70 kDa AR-activator
    • Androgen receptor coactivator 70 kD
    • Androgen receptor coactivator 70 kDa protein
    • Androgen receptor-associated protein of 70 kDa
    • ARA 70
    • ARA70
    • DKFZp762E1112
    • ELE 1
    • ELE1
    • ELE1/ret TK
    • NCOA 4
    • NCoA-4
    • NCOA4
    • NCOA4_HUMAN
    • Nuclear receptor coactivator 4
    • Papillary thyroid carcinoma 3
    • PTC 3
    • PTC3
    • RET activating gene ELE1
    • Ret activating protein ELE1
    • Ret-activating protein ELE1
    • RFG
    see all
  • Function
    Enhances the androgen receptor transcriptional activity in prostate cancer cells. Ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma.
  • Tissue specificity
    Widely expressed. Also detected in adipose tissues and in different cell lines. Isoform Beta is only expressed in testis.
  • Involvement in disease
    Defects in NCOA4 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving NCOA4 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q11.2) generates the RET/NCOA4 (PTC3) oncogene that has been found in sporadic and radiation-associated post-Chernobyl thyroid papillary carcinomas.
  • Information by UniProt

Images

  • ab159934 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159934 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159934.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up