Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRN GTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVG TGNGTRLVVEKEHPQLGAGT
    • Molecular weight
      13 kDa
    • Amino acids
      19 to 138
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151835 is more than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It was lyophilized from a 0.2 µM filtered solution
  • Form
    Lyophilised
  • Additional notes
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • 1C7
    • Activating natural killer receptor p30
    • Activating NK A1 receptor
    • CD337
    • CD337 antigen
    • LY117
    • Lymphocyte antigen 117
    • MALS
    • Natural cytotoxicity triggering receptor 3
    • Natural killer cell p30 related protein
    • Natural killer cell p30-related protein
    • Ncr3
    • NCTR3_HUMAN
    • NK-p30
    • NKp30
    see all
  • Function
    Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation.
  • Tissue specificity
    Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.
  • Sequence similarities
    Belongs to the natural cytotoxicity receptor (NCR) family.
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab151835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up