Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAI GSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRG HDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVS FLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPG G
    • Amino acids
      1 to 201
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1C7
    • Activating natural killer receptor p30
    • Activating NK A1 receptor
    • CD337
    • CD337 antigen
    • LY117
    • Lymphocyte antigen 117
    • MALS
    • Natural cytotoxicity triggering receptor 3
    • Natural killer cell p30 related protein
    • Natural killer cell p30-related protein
    • Ncr3
    • NCTR3_HUMAN
    • NK-p30
    • NKp30
    see all
  • Function
    Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation.
  • Tissue specificity
    Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.
  • Sequence similarities
    Belongs to the natural cytotoxicity receptor (NCR) family.
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab166086 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up