Recombinant human NCR3 protein (Fc Chimera) (ab184896)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRN GTPEFRGRLA PLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLG VGTGNGTRLVVEKEHPQLG
    • Molecular weight
      40 kDa including tags
    • Amino acids
      19 to 135
    • Additional sequence information
      Extracellular domain of NCR3 fused with Fc fragment of Human IgG1 at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab184896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized rh B7-H6 Fc Chimera at 1 µg/mL (100 µL/well), the concentration of NCR3 Fc Chimera that produces 50% of the optimal binding response is found to be approximately 10 - 50 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    pH: 7.50
    Constituents: 0.75% Glycine, 0.605% Tris, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • 1C7
    • Activating natural killer receptor p30
    • Activating NK A1 receptor
    • CD337
    • CD337 antigen
    • LY117
    • Lymphocyte antigen 117
    • MALS
    • Natural cytotoxicity triggering receptor 3
    • Natural killer cell p30 related protein
    • Natural killer cell p30-related protein
    • Ncr3
    • NCTR3_HUMAN
    • NK-p30
    • NKp30
    see all
  • Function
    Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation.
  • Tissue specificity
    Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.
  • Sequence similarities
    Belongs to the natural cytotoxicity receptor (NCR) family.
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab184896; DTT-reduced (1) and non-reduced (2) stained overnight with Coomassie Blue.

    As a result of glycosylation, DTT-reduced Protein migrates as 45-55 kDa and non-reduced protein migrates as 90-110 kDa.

References

ab184896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up