Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMGKSNSKLKPEVVEELTRKTYFTEKEV QQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKD GRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDA IYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADP SIVQALSLYDGLV
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 190
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_055101

Specifications

Our Abpromise guarantee covers the use of ab183224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab183224 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 30% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • 9430075O15Rik
    • A730032G13Rik
    • AI836659
    • DKFZp761L1223
    • FLUP
    • FREQ
    • Frequenin
    • Frequenin homolog
    • Frequenin homolog (Drosophila)
    • Frequenin like protein
    • Frequenin, Drosophila, homolog of
    • Frequenin-like protein
    • Frequenin-like ubiquitous protein
    • Mfreq
    • NCS 1
    • NCS-1
    • ncs1
    • NCS1_HUMAN
    • Neuronal calcium sensor 1
    • Neuronal Calicum Sensor 1
    see all
  • Function
    Neuronal calcium sensor, regulator of G protein-coupled receptor phosphorylation in a calcium dependent manner. Directly regulates GRK1 (RHOK), but not GRK2 to GRK5. Can substitute for calmodulin (By similarity). Stimulates PI4KB kinase activity (By similarity). Involved in long-term synaptic plasticity through its interaction with PICK1 (By similarity). May also play a role in neuron differentiation through inhibition of the activity of N-type voltage-gated calcium channel.
  • Sequence similarities
    Belongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cytoplasm > perinuclear region. Cell membrane. Associated with Golgi stacks. Post-synaptic densities of dendrites, and in the pre-synaptic nerve terminal at neuromuscular junctions.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab183224 (3μg).

References

ab183224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up