Recombinant Human NDFIP2 protein (ab162801)

Overview

  • Product name
    Recombinant Human NDFIP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALET DSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKA AAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFN WLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYW LWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL
    • Amino acids
      1 to 242
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ndfip2
    • NEDD4 family interacting protein 2
    • NEDD4 family-interacting protein 2
    • NEDD4 WW domain binding protein 5A
    • NEDD4 WW domain-binding protein 5A
    • NFIP2_HUMAN
    • Putative MAPK activating protein PM04/PM05/PM06/PM07
    • Putative MAPK-activating protein PM04/PM05/PM06/PM07
    • Putative NF kappa B activating protein 413
    • Putative NF-kappa-B-activating protein 413
    see all
  • Function
    Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. May modulate EGFR signaling.
  • Tissue specificity
    Expressed in brain, lung, heart, skeletal muscle, kidney, liver and placenta.
  • Domain
    The PY (WW-binding) motifs are required for E3 ubiquitin-protein ligase activation and for ubiquitination.
  • Post-translational
    modifications
    Ubiquitinated by NEDD4 and ITCH. Also ubiquitinated by NEDD4L. Ubiquitination by NEDD4 or NEDD4L does not affect turnover.
    Undergoes transient tyrosine-phosphorylation following EGF stimulation, most probably catalyzed by SRC. Also phosphorylated by LYN and FYN.
  • Cellular localization
    Endosome membrane. Golgi apparatus membrane. Endosome > multivesicular body membrane.
  • Information by UniProt

Images

  • ab162801 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up