Overview

  • Product name
    Recombinant Human NDNL2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTS R
    • Amino acids
      2 to 52
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HCA4
    • hepatocellular carcinoma-associated protein 4
    • hepatocellular carcinoma-associated protein HCA4
    • MAGE-G1 antigen
    • MAGEG1
    • MAGEL3
    • melanoma antigen, family G, 1
    • melanoma-associated antigen G1
    • necdin-like 2
    • necdin-like gene 2
    • necdin-like protein 2
    • NSE3
    • NSMCE3
    see all
  • Relevance
    This intronless gene encodes a member of the MAGE superfamily. The encoded protein is 76% identical to the mouse mage-g1 protein.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab163353 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up