Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEGAWALPTWKEEGREQAAGQGEEEECPICTEPYGPRERRLALLNCSHGL CVGCLHRLLGSASSADLGRVRCPLCRQKTPVLEWEICRLQEELLQADGPS RQPRREAPASYHRNPGPWGSLEHRYQLRFLAGPVGGRGCLPFLPCPPCLG ARLWTLRERGPCARRLALLSLLALELLGLLLVFTPLLLLGLLFVLLDRSG R
    • Amino acids
      1 to 201
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA350O14.9
    • MGC138148
    • NADPH dependent diflavin oxidoreductase 1
    • NADPH dependent FMN and FAD containing oxidoreductase
    • NADPH-dependent diflavin oxidoreductase 1
    • NADPH-dependent FMN and FAD-containing oxidoreductase
    • NDOR 1
    • Ndor1
    • NDOR1_HUMAN
    • Novel reductase 1
    • NR 1
    • NR1
    • OTTHUMP00000064742
    • RP11 350O14.11
    see all
  • Function
    Oxidoreductase that catalyzes the NADP-dependent reduction of cytochrome c and one-electron acceptors, such as doxorubicin, potassium ferricyanide and menadione (in vitro).
  • Tissue specificity
    Low expression in brain, heart, kidney, pancreas, prostate and skeletal muscle. Highest levels in the placenta. Expressed in cancer cell lines including promyelocytic leukemia, HeLa S3, chronic myelagenous leukemia, lymphoblastic leukemia, Burkitt's lymphoma, colorectal adenocarcinoma, lung carcinoma, and melanoma G361.
  • Sequence similarities
    In the C-terminal section; belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 flavodoxin-like domain.
  • Cellular localization
    Cytoplasm > perinuclear region. Concentrated in perinuclear structure.
  • Information by UniProt

Images

  • ab162102 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up