Overview

  • Product name
    Recombinant Human NDRG4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTF FNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVV QHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWA ATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQL FWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKL DPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARS RTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC
    • Amino acids
      1 to 339
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BDM1
    • Brain development-related molecule 1
    • KIAA1180
    • Ndrg4
    • NDRG4_HUMAN
    • Protein NDRG4
    • SMAP 8
    • SMAP-8
    • Vascular smooth muscle cell-associated protein 8
    see all
  • Function
    May play a role in the early postnatal development and function of neuronal cells.
  • Tissue specificity
    Expressed only in brain and heart. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain.
  • Sequence similarities
    Belongs to the NDRG family.
  • Information by UniProt

Images

  • ab163915 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up