Overview

  • Product nameRecombinant Human NDST1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP52848
    • SpeciesHuman
    • SequenceLYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLV FVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
    • Molecular weight37 kDa including tags
    • Amino acids38 to 136

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • [Heparan sulfate]-glucosamine N-sulfotransferase 1
    • Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
    • Glucosaminyl N-deacetylase/N-sulfotransferase 1
    • Heparan sulfate N-deacetylase 1
    • Heparan sulfate N-sulfotransferase 1
    • HSNST 1
    • HSST
    • HSST1
    • N-heparan sulfate sulfotransferase 1
    • N-HSST 1
    • NDST-1
    • Ndst1
    • NDST1_HUMAN
    see all
  • FunctionEssential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response.
  • Tissue specificityWidely expressed. Expression is most abundant in heart, liver and pancreas.
  • PathwayGlycan metabolism; heparan sulfate biosynthesis.
    Glycan metabolism; heparin biosynthesis.
  • Sequence similaritiesBelongs to the sulfotransferase 1 family. NDST subfamily.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

Recombinant Human NDST1 protein images

  • 12.5% SDS-PAGE of ab116875 at approximately 36.52kDa, stained with Coomassie Blue.

References for Recombinant Human NDST1 protein (ab116875)

ab116875 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"