Overview

  • Product name
    Recombinant Human NDST2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FRAHEHSLLSAQLKGFPLFLHSNLGLRDYQVNPSAPLLHLTRPSRLEPGP LPGDDWTIFQSNHSTYEPVLLASLRPAEPAVPGPVLRRARLPTVVQDLG
    • Amino acids
      172 to 270
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • [Heparan sulfate]-glucosamine N-sulfotransferase
    • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
    • Glucosaminyl N-deacetylase/N-sulfotransferase 2
    • glucosaminyl N-deacetylase/N-sulphotransferase 2
    • heparan glucosaminyl N-deacetylase/N-sulfotransferase 2
    • heparan N-sulfotransferase 2
    • heparan sulfate N-deacetylase/N-sulfotransferase 2
    • Heparan sulfate N-sulfotransferase 2
    • HSST2
    • mastocytoma N-deacetylase/N-sulfotransferase
    • Mndns
    • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2
    • N-heparan sulfate sulfotransferase 2
    • N-HSST 2
    • NDST-2
    • NDST2
    • NDST2_HUMAN
    • NST2
    see all
  • Function
    Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate.
  • Pathway
    Glycan metabolism; heparan sulfate biosynthesis.
    Glycan metabolism; heparin biosynthesis.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family. NDST subfamily.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160065 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up