Overview

  • Product name
    Recombinant Human NDST3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLE KGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH
    • Amino acids
      162 to 259
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bifunctional heparan sulfate N deacetylase/N sulfotransferase 3
    • Glucosaminyl N deacetylase/N sulfotransferase 3
    • Glucosaminyl N-deacetylase/N-sulfotransferase 3
    • Heparan sulfate N-sulfotransferase 3
    • hNDST 3
    • hNDST-3
    • hNDST3
    • HSST 3
    • HSST3
    • MGC130028
    • MGC130029
    • N deacetylase/N sulfotransferase (heparan glucosaminyl) 3
    • N heparan sulfate sulfotransferase 3
    • N HSST 3
    • N-heparan sulfate sulfotransferase 3
    • N-HSST 3
    • NDST 3
    • NDST-3
    • NDST3
    • NDST3_HUMAN
    • PRO4998
    • UNQ2544
    see all
  • Function
    Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Has high deacetylase activity but low sulfotransferase activity.
  • Tissue specificity
    Expressed in brain, kidney, liver, fetal and adult lung, adult pancreas, placenta, fetal spleen and fetal thymus. Not detected in adult/ fetal heart and skeletal muscle.
  • Pathway
    Glycan metabolism; heparan sulfate biosynthesis.
    Glycan metabolism; heparin biosynthesis.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family. NDST subfamily.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160446 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up