Recombinant Human NDUFA8 protein (ab158966)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEE KDPRRCLEEGKLVNKCALDFFR
    • Amino acids
      1 to 72
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CI 19KD
    • CI PGIV
    • CI-19kD
    • CI-PGIV
    • Complex I 19k
    • Complex I 19kD
    • Complex I PGIV
    • Complex I PGIV subunit
    • Complex I-19kD
    • Complex I-PGIV
    • MGC793
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8 (19kD PGIV)
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8 19kDa
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
    • NADH ubiquinone oxidoreductase 19 kDa subunit
    • NADH ubiquinone oxidoreductase PGIV subunit
    • NADH-ubiquinone oxidoreductase 19 kDa subunit
    • NDUA8_HUMAN
    • NDUFA 8
    • NDUFA8
    • OTTHUMP00000022034
    • PGIV
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFA8 subunit family.
    Contains 2 CHCH domains.
  • Domain
    Contains four C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds.
  • Post-translational
    modifications
    May contain intrachain disulfide bonds, as evidenced by its electrophoretic mobility under reducing vs non-reducing conditions.
  • Cellular localization
    Mitochondrion. Mitochondrion intermembrane space.
  • Information by UniProt

Images

  • ab158966 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up