Recombinant Human NDUFA9 protein (ab114712)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEV LRRHRTYRWLSAEIEDVKPAKTVNI
    • Molecular weight
      34 kDa including tags
    • Amino acids
      303 to 377

Specifications

Our Abpromise guarantee covers the use of ab114712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CI-39kD
    • Complex I subunit NDUFA9
    • Complex I-39kD
    • mitochondrial
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial
    • NADH Ubiquinone Oxidoreductase 1 alpha subcomplex 9
    • NADH-ubiquinone oxidoreductase 39 kDa subunit
    • NDUA9_HUMAN
    • NDUFA9
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFA9 subunit family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114712 at approximately 33.88 kDa stained with Coomassie Blue.

References

ab114712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up