Recombinant Human NDUFB6 protein (ab116994)

Overview

  • Product name
    Recombinant Human NDUFB6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKF LENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEK KSRIFPGDTILETGEVIPPMKEFPDQHH
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 128

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • B17
    • CI
    • CI B17
    • CI-B17
    • Complex I mitochondrial respiratory chain B17 subunit
    • Complex I-B17
    • Complex IB17
    • MGC13675
    • NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
    • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
    • NADH ubiquinone oxidoreductase B17 subunit
    • NADH ubiquinone oxidoreductase beta subunit 6
    • NADH-ubiquinone oxidoreductase B17 subunit
    • NDUB6_HUMAN
    • NDUFB6
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFB6 subunit family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116994 at approx. 39.82kDa.
    Stained with Coomassie Blue.

References

ab116994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up