Recombinant Human NDUFB8 protein (ab152558)

Overview

  • Product name
    Recombinant Human NDUFB8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAA AAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLN WGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVY PVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
    • Molecular weight
      46 kDa including tags
    • Amino acids
      1 to 186

Specifications

Our Abpromise guarantee covers the use of ab152558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ASHI
    • CI-ASHI
    • Complex I ASHI subunit
    • Complex I-ASHI
    • mitochondrial
    • NADH dehydrogenase (ubiquinone) 1 beta subcomplex 8 19kDa
    • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8
    • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 mitochondrial
    • NADH-ubiquinone oxidoreductase ASHI subunit
    • NDUB8_HUMAN
    • NDUFB8
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFB8 subunit family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152558 stained with Coomassie Blue.

References

ab152558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up