Recombinant Human NDUFS2 protein (ab114810)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75306
    • SpeciesHuman
    • SequenceSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVS DGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR
    • Molecular weight37 kDa including tags
    • Amino acids364 to 463

Specifications

Our Abpromise guarantee covers the use of ab114810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CI 49
    • CI 49kD
    • CI-49kD
    • Complex 1, mitochondrial respiratory chain, 49 KD subunit
    • Complex I 49kD
    • Complex I 49kDa subunit
    • Complex I-49kD
    • mitochondrial
    • NADH dehydrogenase (ubiquinone) Fe S protein 2 49kDa
    • NADH dehydrogenase (ubiquinone) Fe S protein 2, 49kDa (NADH coenzyme Q reductase)
    • NADH dehydrogenase [ubiquinone] iron sulfur protein 2, mitochondrial
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 2
    • NADH ubiquinone oxidoreductase 49 kDa subunit
    • NADH ubiquinone oxidoreductase NDUFS2 subunit
    • NADH-ubiquinone oxidoreductase 49 kDa subunit
    • NADH:ubiquinone oxidoreductase core subunit S2
    • Ndufs2
    • NDUS2_HUMAN
    see all
  • FunctionCore subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in diseaseDefects in NDUFS2 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similaritiesBelongs to the complex I 49 kDa subunit family.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt

Recombinant Human NDUFS2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human NDUFS2 protein (ab114810)

ab114810 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"