Recombinant Human NDUFS8 protein (ab158982)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKS VTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHA LRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKC IYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIA ANIQADYLYR
    • Amino acids
      1 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CI 23kD
    • CI-23kD
    • Complex I 23kD
    • Complex I-23kD
    • EC 1.6.5.3
    • EC 1.6.99.3
    • Human mitochondrial NADH dehydrogenase ubiquinone Fe S protein 8
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
    • NADH ubiquinone oxidoreductase 23 kDa subunit
    • NADH-ubiquinone oxidoreductase 23 kDa subunit
    • NDUFS8
    • NDUS8_HUMAN
    • TYKY
    • TYKY subunit
    • Ubiquinoneiron sulfur protein 8, mitochondrial precursor
    see all
  • Function
    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). May donate electrons to ubiquinone.
  • Involvement in disease
    Defects in NDUFS8 are a cause of Leigh syndrome (LS) [MIM:256000]. LS is a severe neurological disorder characterized by bilaterally symmetrical necrotic lesions in subcortical brain regions.
  • Sequence similarities
    Belongs to the complex I 23 kDa subunit family.
    Contains 2 4Fe-4S ferredoxin-type domains.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab158982 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up