Recombinant Human NDUFV2 protein (ab116815)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPD TPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNK VAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILE AIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKD IEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
    • Molecular weight
      53 kDa including tags
    • Amino acids
      1 to 249

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 24kDa subunit of Complex I
    • CI-24k
    • complex I 24kDa subunit
    • complex I, mitochondrial respiratory 2
    • mitochondrial
    • NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
    • NADH dehydrogenase [ubiquinone] flavoprotein 2
    • NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
    • NADH ubiquinone oxidoreductase 24 kDa subunit
    • NADH-ubiquinone oxidoreductase 24 kDa subunit
    • NADH-ubiquinone oxidoreductase flavoprotein 2
    • NDUFV2
    • NDUV2_HUMAN
    • nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit
    • Ubiquinoneflavoprotein 2, mitochondrial precursor
    see all
  • Function
    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I 24 kDa subunit family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Recombinant Human NDUFV2 protein images

  • 12.5% SDS-PAGE showing ab116815 at approximately 53.46kDa.
    Stained with Coomassie Blue.

References for Recombinant Human NDUFV2 protein (ab116815)

ab116815 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up