Recombinant Human NDUFV2 protein (ab152561)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAK DIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      150 to 249

Specifications

Our Abpromise guarantee covers the use of ab152561 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 24kDa subunit of Complex I
    • CI-24k
    • complex I 24kDa subunit
    • complex I, mitochondrial respiratory 2
    • mitochondrial
    • NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
    • NADH dehydrogenase [ubiquinone] flavoprotein 2
    • NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
    • NADH ubiquinone oxidoreductase 24 kDa subunit
    • NADH-ubiquinone oxidoreductase 24 kDa subunit
    • NADH-ubiquinone oxidoreductase flavoprotein 2
    • NDUFV2
    • NDUV2_HUMAN
    • nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit
    • Ubiquinoneflavoprotein 2, mitochondrial precursor
    see all
  • Function
    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I 24 kDa subunit family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152561 stained with Coomassie Blue.

References

ab152561 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152561.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up