Recombinant Human Nebulin protein (ab114753)

Overview

  • Product nameRecombinant Human Nebulin protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20929
    • SpeciesHuman
    • SequenceNTKTSYHTPADMLSVTAAKDAQANITNTNYKHLIHKYILLPDAMNIELTR NMNRIQSDNEYKQDYNEWYKGLGWSPAGSLEVEKAKKATEYASDQKYRQH PSNFQFKKLT
    • Molecular weight38 kDa including tags
    • Amino acids2108 to 2217

Specifications

Our Abpromise guarantee covers the use of ab114753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686C1456
    • FLJ11505
    • FLJ36536
    • FLJ39568
    • FLJ39584
    • NEB
    • NEB 177D
    • NEB177D
    • NEBU_HUMAN
    • Nebulin
    • NEM 2
    • NEM2
    see all
  • FunctionThis giant muscle protein may be involved in maintaining the structural integrity of sarcomeres and the membrane system associated with the myofibrils. Bind and stabilize F-actin.
  • Tissue specificityMuscle specific. Located in the thin filament of striated muscle.
  • Involvement in diseaseDefects in NEB are the cause of nemaline myopathy type 2 (NEM2) [MIM:256030]. A form of nemaline myopathy. Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-or rod-like structures in muscle fibers on histologic examination.
  • Sequence similaritiesContains 178 nebulin repeats.
    Contains 1 SH3 domain.
  • Cellular localizationCytoplasm > myofibril > sarcomere. Cytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human Nebulin protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114753 at approximately 37.73kDa.

References for Recombinant Human Nebulin protein (ab114753)

ab114753 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"