Recombinant Human NECAP2 protein (ab104638)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEESGYESVLCVKPDVHVYRIPPRATNRGY RAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTA VESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVK QQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPA STGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWP QPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 263
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab104638 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Adaptin ear binding coat associated protein 2
    • Adaptin ear-binding coat-associated protein 2
    • FLJ10420
    • NECAP endocytosis associated 2
    • NECAP endocytosis associated protein 2
    • NECAP endocytosis-associated protein 2
    • NECAP-2
    • NECAP2
    • NECP2_HUMAN
    see all
  • Function
    Involved in endocytosis.
  • Sequence similarities
    Belongs to the NECAP family.
  • Domain
    The WXXF motifs mediate binding of accessory proteins to the ear-domain of AP-1, GGAs and AP-2 through hydrophobic interactions. Selective binding to the GAE domains of AP-1 or to the alpha-ear domain of AP-2 is tuned by the acidic context surrounding the motif and the properties of the second residue of the motif itself.
  • Cellular localization
    Cytoplasmic vesicle, clathrin-coated vesicle membrane. Cell membrane. Colocalizes with AP-2 at the plasma membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104638.

References

ab104638 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up