Recombinant Human NECAP2 protein (ab104638)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEESGYESVLCVKPDVHVYRIPPRATNRGY RAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTA VESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVK QQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPA STGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWP QPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 263
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab104638 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Adaptin ear binding coat associated protein 2
    • Adaptin ear-binding coat-associated protein 2
    • FLJ10420
    • NECAP endocytosis associated 2
    • NECAP endocytosis associated protein 2
    • NECAP endocytosis-associated protein 2
    • NECAP-2
    • NECAP2
    • NECP2_HUMAN
    see all
  • Function
    Involved in endocytosis.
  • Sequence similarities
    Belongs to the NECAP family.
  • Domain
    The WXXF motifs mediate binding of accessory proteins to the ear-domain of AP-1, GGAs and AP-2 through hydrophobic interactions. Selective binding to the GAE domains of AP-1 or to the alpha-ear domain of AP-2 is tuned by the acidic context surrounding the motif and the properties of the second residue of the motif itself.
  • Cellular localization
    Cytoplasmic vesicle, clathrin-coated vesicle membrane. Cell membrane. Colocalizes with AP-2 at the plasma membrane.
  • Information by UniProt

Recombinant Human NECAP2 protein images

  • 15% SDS-PAGE analysis of 3µg ab104638.

References for Recombinant Human NECAP2 protein (ab104638)

ab104638 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up