Recombinant Human Necdin protein (ab114538)

Overview

  • Product nameRecombinant Human Necdin protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99608
    • SpeciesHuman
    • SequenceMSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTA APQAAPPPQAPNDEGDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQ KAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARV FGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYV KGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRV PYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEE ARALREANPTAHYPRSSVSED
    • Molecular weight61 kDa including tags
    • Amino acids1 to 321

Specifications

Our Abpromise guarantee covers the use of ab114538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HsT16328
    • NDN
    • NECD_HUMAN
    • Necdin
    • Necdin homolog
    • necdin related protein
    • PWCR
    see all
  • FunctionGrowth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences.
  • Tissue specificityAlmost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in peripheral blood leukocytes. In brain, restricted to post-mitotic neurons.
  • Sequence similaritiesContains 1 MAGE domain.
  • Cellular localizationPerikaryon. Nucleus. Neural perikarya, translocates to the nucleus of postmitotic neurons and interacts with the nuclear matrix.
  • Information by UniProt

Recombinant Human Necdin protein images

  • 12.5% SDS-PAGE showing ab114538 at approximately 61.38kDa stained with Coomassie Blue.

References for Recombinant Human Necdin protein (ab114538)

ab114538 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"