Recombinant Human Necdin protein (ab114538)

Overview

  • Product name
    Recombinant Human Necdin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTA APQAAPPPQAPNDEGDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQ KAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARV FGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYV KGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRV PYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEE ARALREANPTAHYPRSSVSED
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1 to 321

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HsT16328
    • NDN
    • NECD_HUMAN
    • Necdin
    • Necdin homolog
    • Necdin MAGE family member
    • necdin related protein
    • PWCR
    see all
  • Function
    Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences.
  • Tissue specificity
    Almost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in peripheral blood leukocytes. In brain, restricted to post-mitotic neurons.
  • Sequence similarities
    Contains 1 MAGE domain.
  • Cellular localization
    Perikaryon. Nucleus. Neural perikarya, translocates to the nucleus of postmitotic neurons and interacts with the nuclear matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114538 at approximately 61.38kDa stained with Coomassie Blue.

References

ab114538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up