Recombinant Human NEDD8 protein (FITC) (ab190449)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQM NDEKTAADYKILGGSVLHLVLALRGG
    • Molecular weight
      9 kDa
    • Amino acids
      1 to 76
    • Modifications
      2-amino acetoacetate replaces
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm

Specifications

Our Abpromise guarantee covers the use of ab190449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Additional notes

    ab190449 is modified with fluorescein via primary amine coupling. This results in multiple fluoresceinated NEDD8 species with modified lysines as well as the N-terminus.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • FLJ43224
    • MGC104393
    • MGC125896
    • MGC125897
    • NED8
    • NEDD 8
    • NEDD-8
    • Nedd8
    • NEDD8_HUMAN
    • Neddylin
    • Neural precursor cell expressed developmentally down regulated 8
    • Neural precursor cell expressed developmentally down regulated gene 8
    • Neural precursor cell expressed developmentally down-regulated protein 8
    • Rub1
    • Ubiquitin like protein Nedd 8
    • Ubiquitin like protein Nedd8
    • Ubiquitin-like protein Nedd8
    see all
  • Function
    Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.
  • Tissue specificity
    Highly expressed in heart, skeletal muscle, spleen, thymus, prostate, testis, ovary, colon and leukocytes.
  • Sequence similarities
    Belongs to the ubiquitin family.
  • Post-translational
    modifications
    Cleavage of precursor form by UCHL3 or SENP8 is necessary for function.
  • Cellular localization
    Nucleus. Mainly nuclear.
  • Information by UniProt

References

ab190449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up