Overview

  • Product nameRecombinant Human NEIL2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ969S2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMPEGPLVRKFHHLVSPFVGQQVVKTG GSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQK EVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGD AGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLA FYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYF SGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKF QGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEP EQCQFS
    • Molecular weight39 kDa including tags
    • Amino acids1 to 332
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab124545 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • DNA glycosylase/AP lyase Neil2
    • DNA-(apurinic or apyrimidinic site) lyase Neil2
    • Endonuclease 8-like 2
    • Endonuclease VIII-like 2
    • NEH2
    • Nei endonuclease VIII like 2
    • Nei endonuclease VIII like 2 (E. coli)
    • Nei homolog 2
    • Nei-like 2
    • Nei-like protein 2
    • NEI2
    • NEIL2
    • NEIL2_HUMAN
    see all
  • FunctionInvolved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.
  • Tissue specificityDetected in testis, skeletal muscle, heart, brain, placenta, lung, pancreas, kidney and liver.
  • Sequence similaritiesBelongs to the FPG family.
    Contains 1 FPG-type zinc finger.
  • DomainThe zinc-finger domain is important for DNA binding.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human NEIL2 protein images

  • 15% SDS-PAGE analysis of 3 µg ab124545.

References for Recombinant Human NEIL2 protein (ab124545)

ab124545 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"