Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96PY6
    • SpeciesHuman
    • SequenceDVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKN KNKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQD
    • Molecular weight37 kDa including tags
    • Amino acids976 to 1075

Specifications

Our Abpromise guarantee covers the use of ab116949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686D06121
    • DKFZp686K12169
    • kat
    • KIAA1901
    • MGC138800
    • MGC189817
    • NEK1
    • NEK1_HUMAN
    • Never in mitosis A-related kinase 1
    • Never in mitosis gene A-related kinase 1
    • NIMA (never in mitosis gene a)-related kinase 1
    • NIMA-related kinase 1
    • NimA-related protein kinase 1
    • NY-REN-55
    • OTTHUMP00000219432
    • OTTHUMP00000219433
    • OTTHUMP00000219434
    • OTTHUMP00000219435
    • Protein-serine/threonine kinase
    • Renal carcinoma antigen NY-REN-55
    • Serine/threonine-protein kinase Nek1
    • SRPS2
    • SRPS2A
    • SRTD6
    see all
  • FunctionPhosphorylates serines and threonines, but also appears to possess tyrosine kinase activity. Implicated in the control of meiosis (By similarity). Involved in cilium assembly. In response to injury that includes DNA damage, NEK1 phosphorylates VDAC1 to limit mitochondrial cell death.
  • Tissue specificityHigh fetal expression in the brain and kidney.
  • Involvement in diseaseShort-rib thoracic dysplasia 6 with or without polydactyly
  • Sequence similaritiesBelongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
  • Cellular localizationNucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Associated with the pericentriolar material. Localizes to centrosome during interphase and mitosis (By similarity).
  • Information by UniProt

Recombinant Human NEK1 protein images

  • 12.5% SDS-PAGE showing ab116949 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human NEK1 protein (ab116949)

ab116949 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"